General Information

  • ID:  hor003241
  • Uniprot ID:  A0A8C2TPG4
  • Protein name:  Neuropeptide 2
  • Gene name:  PNOC
  • Organism:  Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)
  • Family:  Opioid neuropeptide precursor family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Coturnix (genus), Perdicinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  FSEFLKQYLGMSPR
  • Length:  14(163-176)
  • Propeptide:  MRAVLWDLLLLCLFARARSDCRGDCLRCDRHFYHDGFDLLVCILECEGEAVPRATWEMCATSIRSAPRPGATGVLGAMEPAEAVASPLQVSELLRRRDAEDGGAGMAPGAFPSQDEDISRRLGGGFPRETRGSWPAARGVQKRYGGFIGVRKSARKWNNQKRFSEFLKQYLGMSPRSTFRHRIPAPSARHRQN
  • Signal peptide:  MRAVLWDLLLLCLFARARS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor003241_AF2.pdbhor003241_ESM.pdb

Physical Information

Mass: 193503 Formula: C79H119N19O21S
Absent amino acids: ACDHINTVW Common amino acids: FLS
pI: 9.3 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 4
Hydrophobicity: -37.14 Boman Index: -2067
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 55.71
Instability Index: 8589.29 Extinction Coefficient cystines: 1490
Absorbance 280nm: 114.62

Literature

  • PubMed ID:  20298575
  • Title:  Neuropeptidomic Analysis of the Embryonic Japanese Quail Diencephalon